SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000043780 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000043780
Domain Number 1 Region: 37-76
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000759
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000043780
Sequence length 92
Comment (Bos taurus)
Sequence
MANLTGTIKGLYPETLSPEQLEKLRGFKIQTRITNEKYLRTHKEVELLISGFFREMFLKR
PDNIPEFAADYFTDPRLPNKIHMQLIKEKKAA
Download sequence
Identical sequences L8IP99 Q32PB2
ENSBTAP00000043780 ENSBTAP00000043780 9913.ENSBTAP00000043780 NP_001070517.1.59421 NP_001070517.1.76553 XP_005895030.1.15283 XP_006050851.1.26621 XP_010855787.1.44457 XP_019811048.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]