SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000049106 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  9913.ENSBTAP00000049106
Domain Number - Region: 18-46
Classification Level Classification E-value
Superfamily BAG domain 0.0643
Family BAG domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000049106
Sequence length 58
Comment (Bos taurus)
Sequence
APLCFHKRNMQPRERRLIDSVQNPLNGQARKKRRSQVQKAKGSLRYYKIPQGKESVNS
Download sequence
Identical sequences 9913.ENSBTAP00000049106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]