SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000052315 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000052315
Domain Number 1 Region: 86-198
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.51e-26
Family Canonical RBD 0.0029
Further Details:      
 
Weak hits

Sequence:  9913.ENSBTAP00000052315
Domain Number - Region: 37-69
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0745
Family Mitotic arrest deficient-like 1, Mad1 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000052315
Sequence length 227
Comment (Bos taurus)
Sequence
RWGGRGGGPGGRRGLRNGLESEELEPEELLLEPEPEDPELEAIKARVREMEEEAEKLKEL
QNEVEKQMNMSPPPGNAGPVIMSIEEKIEADARSIYVGNVDYGATAEELEAHFHGCGSVN
RVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDR
GFPRTRYRARTTNYNSTRSRFYSGFNSRPRGRVYRGRARATSWYSPY
Download sequence
Identical sequences 9913.ENSBTAP00000052315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]