SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000052492 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000052492
Domain Number 1 Region: 95-283
Classification Level Classification E-value
Superfamily TRAF domain-like 3.14e-59
Family SIAH, seven in absentia homolog 0.00000000904
Further Details:      
 
Domain Number 2 Region: 36-98
Classification Level Classification E-value
Superfamily RING/U-box 0.0000294
Family RING finger domain, C3HC4 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000052492
Sequence length 284
Comment (Bos taurus)
Sequence
LTFKSRQPRTTKYSGNSNQNSSFENFFTGTTSCNSEWASLFQCPICFDYVLPPILQCHSG
HLVWSNCRPKISRCPTCRDPLRSIRNLAMEKVADSVLFPCKYASSGCEITLTHTEKADHE
EFCEFRPYSCPCPGASCKWQGSRDAVIPHLMHQHESITTLQGEDIVFLATGINLPGAVDW
VMMQSCFGFHFILVLEKQEKYVGHHQFFAIVQLIGTRKQAEDFAYRLELNGPRRRLTWEA
TPRSTHEGIATAITNSDCLVFDTRVAQFFAENGNLGINVTISMC
Download sequence
Identical sequences 9913.ENSBTAP00000052492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]