SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9986.ENSOCUP00000007420 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9986.ENSOCUP00000007420
Domain Number 1 Region: 64-187
Classification Level Classification E-value
Superfamily TNF-like 1.61e-51
Family TNF-like 0.0000142
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9986.ENSOCUP00000007420
Sequence length 187
Comment (Oryctolagus cuniculus)
Sequence
MEGVRPLEENVGNAPRPRFERNKLLLVASVVQALGLLLCLTYVCQHSHAPEVSLQYPPIE
NIMTQLQILTSHECEEDSFILPLQKRDGTMEVQNNSVVIQCDGFYLLSLKGYFSQEVSIS
LHYRKGEEPFPILKKTKFANSNVVLKLGYKDKVYLNVTTDSASCKQLSVNAGELIVILQN
PGGYCAP
Download sequence
Identical sequences A0A0U5J5S0 O02765
9986.ENSOCUP00000007420 ENSOCUP00000007420 NP_001075454.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]