SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9986.ENSOCUP00000007714 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9986.ENSOCUP00000007714
Domain Number 1 Region: 110-181
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 4.84e-19
Family F1F0 ATP synthase subunit C 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9986.ENSOCUP00000007714
Sequence length 182
Comment (Oryctolagus cuniculus)
Sequence
RLVGPGRARAEPSCRCPASPSPLCLLCTGSSSGATAPDSLTMYACSKFVSTPSLARSTSQ
LLSRPLSAVVLKRPEPLTDEVPYSVAAPCPLTPLLQSRSFQTSVVSRDIDTAAKFIGAGA
ATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF
AM
Download sequence
Identical sequences G1SW65
ENSOCUP00000007714 ENSOCUP00000007714 9986.ENSOCUP00000007714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]