SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9986.ENSOCUP00000013664 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  9986.ENSOCUP00000013664
Domain Number - Region: 3-65
Classification Level Classification E-value
Superfamily TIMP-like 0.00573
Family Netrin-like domain (NTR/C345C module) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9986.ENSOCUP00000013664
Sequence length 65
Comment (Oryctolagus cuniculus)
Sequence
FCAGSRYIVMGHIYHKRRQLPAALLQVLRGRLRPGDGLLGTGSGYAKRFNRRRAGRVQGA
ALTQC
Download sequence
Identical sequences G1TAH2
9986.ENSOCUP00000013664 ENSOCUP00000013664 ENSOCUP00000013664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]