SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9986.ENSOCUP00000016792 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9986.ENSOCUP00000016792
Domain Number 1 Region: 60-171
Classification Level Classification E-value
Superfamily TNF-like 1.37e-26
Family TNF-like 0.00000368
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9986.ENSOCUP00000016792
Sequence length 178
Comment (Oryctolagus cuniculus)
Sequence
MHLSHMESLPVSHSSHQGAQRSSWKLWLLCSTVLLLLLCSLSTLILTFLPLKQTAKEACV
AKFGPLPSKWQMEPPKPSCVNKISDWKLKILQNGLYIIYGQVAPDPTYKGFAPFEVQLCK
NKEAIQTLTNNSKIQNLGGIYEFDAGDIIELRFNSDDQVLKNNTYWGIVLLVTPQFSS
Download sequence
Identical sequences A0A0U5J6U4
9986.ENSOCUP00000016792 ENSOCUP00000016792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]