SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000014882 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000014882
Domain Number 1 Region: 10-80
Classification Level Classification E-value
Superfamily SNARE fusion complex 5e-22
Family SNARE fusion complex 0.0000294
Further Details:      
 
Domain Number 2 Region: 128-201
Classification Level Classification E-value
Superfamily SNARE fusion complex 1.23e-20
Family SNARE fusion complex 0.0000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000014882
Sequence length 204
Comment (Tetraodon nigroviridis)
Sequence
MADEADMRNELADLQTRADQIADESLESTRRMLALVEESKDAGIRTLVMLDEQGEQLERI
EEGMDQINKDMKDAEKNLNNLGQFCGLCSCPCNKIKGGGQAWGGNQDGVVNSQPGARVVD
EREQMAISGGFIRRVTDDARENEMDENLEQVGGIIGNLRHMALDMGQEIDTQNRQIDRIM
EKADSNKTRIDEANQRATKMLGSG
Download sequence
Identical sequences H3D2Z4
ENSTNIP00000014882 XP_022071547.1.10920 ENSTNIP00000014882 99883.ENSTNIP00000014882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]