SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000019537 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000019537
Domain Number 1 Region: 1-89
Classification Level Classification E-value
Superfamily RING/U-box 1.34e-40
Family RING finger domain, C3HC4 0.00023
Further Details:      
 
Domain Number 2 Region: 363-485
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.68e-37
Family Ankyrin repeat 0.00031
Further Details:      
 
Domain Number 3 Region: 515-615
Classification Level Classification E-value
Superfamily BRCT domain 6.11e-20
Family BRCT domain 0.032
Further Details:      
 
Domain Number 4 Region: 571-719
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000000209
Family DNA topoisomerase II binding protein 1, TopBP1 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000019537
Sequence length 721
Comment (Tetraodon nigroviridis)
Sequence
WKNTKEAVANFRRLLLCSKCSKLMKEPVCLGMCEHVLCRSCAGPRAGDGCVVCHSPAWVK
DIQINRQLSSITEIFTNLESLLKPAEQPDHSLDNTKAEIECSVLKQKKSFKIWFSPRSRK
VRCLVEKPSEDTSPESRSTRGAGPDSGSSSSPNSRNKRSNRKKIATRKQTKKTMKRNKLE
AINQQWGITGQADSPNQKEQTYDEGVSFLSPAGTTDDPQPEVPQASSSAHRPDTSPILGN
LSENDSVLNEQTQSSATQTDAPSVHVPGFGGSSATRDYVSPLKRPSYTCKADDKVTTLET
TPKRPRVSPARGRKSQISPAVLNPSPSTSPGCDKKKRIQQQCESPPVQRSPCSQRSASGS
PAILKRNYKGETPLHIASIKGDVEAVKELLDQGADPNLKDNAGWTPLHEACNLGHLAVVE
VLVSRGALLNTPGYENDSPLHDAVRNGHLAIAKLLLQLGASRNVLNLYGKQPADYAVSLE
MREIFQHASDGTATPLSPSANLSVVSGSVRKEELVLLATKLLQPEQQQLVKLGQLLGGRV
VDTFSASVSHIVLPEGQMCTTFSTLLGVLAGCWVVKYTWVQACLQAERWMPEAEHEAGEG
PQRSRVNRCSLLPPLFDGCFFFLLGSFKSPSKDELARLLKEGGGQLLSRQPKPDSDVTQT
VSAAAYHAPAGSDQALCTQYIIFDPQGRHRPAVVRRGKVWSAPSTWIIDCIAAFCLLPVP
D
Download sequence
Identical sequences H3DG93
ENSTNIP00000019537 ENSTNIP00000019537 99883.ENSTNIP00000019537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]