SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000020281 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000020281
Domain Number 1 Region: 9-113
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.23e-22
Family alpha-D-mannose-specific plant lectins 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000020281
Sequence length 116
Comment (Tetraodon nigroviridis)
Sequence
MSINVLDKGTEWKKGDFVLSKNGEWKAVFQEDGNFVVYGWQPVWASDTGGLDPTRLCMQA
DCNLVMYNPEEKPRWHTNTAKGSCDTCTLYLTDQGKLVLKKNGNEIWNSDHNHGMK
Download sequence
Identical sequences Q4RMX9
ENSTNIP00000020281 ENSTNIP00000020281 99883.ENSTNIP00000020281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]