SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 99883.ENSTNIP00000020573 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  99883.ENSTNIP00000020573
Domain Number 1 Region: 314-352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000002
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 2 Region: 431-468
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000103
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 3 Region: 261-396
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000251
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 4 Region: 388-435
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000954
Family EGF-type module 0.015
Further Details:      
 
Domain Number 5 Region: 469-508
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000473
Family EGF-type module 0.023
Further Details:      
 
Weak hits

Sequence:  99883.ENSTNIP00000020573
Domain Number - Region: 157-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.026
Family Integrin beta EGF-like domains 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 99883.ENSTNIP00000020573
Sequence length 691
Comment (Tetraodon nigroviridis)
Sequence
MAVCFTTTFAMLTTIFTQVLGSGVFEIDLQQFQNTKGLLANGDACGTAGCRTYFTVCLKN
FQTVVSPEKCIFGKVTTPVLGTNSFNIQQDARLRLPLNFTWPGSFSLLIEAWCAPAEDQP
GDTTNPDFLISSFAIQRQLGIGHEWSQDVQSGEQTELRYSYRCICNDNYYGDTCSKVCNP
RDDHFGHFTCKPDGQIACLPGWKGEYCQEPVCYEGCSERNGNCTLPGECKCRKGWQGPSC
DVCEVHPSCKHGTCNEPWQCICKQGWGGIYCNQDLNYCTHHKPCANGATCMNTGQGSYTC
ACLPGFTGVNCDLEIRECDSQPCRNGGHCLDSENGYTCECPQGFEGTHCEHKKLTCADMP
CFHEGQCKETKNGHAYMCECAAGYTGLNCERKVDKCTSLQCTNAGGHCVDNGNLHLCRCL
PGFTGSRCETNINECAKNPCTNGSTCLDGMNNYVCICPPGYTGRHCENPTDCCASQPCLN
GGTCTTGPKGRPLCICPTHFSGPQCQSCSVPTPTPQPTPKTPIVLGVGLVAVLVFACMVG
LVICHVRKRRKRDQDSETMNNRSKSDFQKENLLSTLEIKNNNKKVDLEVDCPSGKSNHKH
INHYQLDYKASMGYKDELFFQDKDENCEKIGDKKHLSRLYRLLITDTLFFSPHSQRPECK
ISTICSPRDSMYQSVFVIAEEKNECIIATEV
Download sequence
Identical sequences H3DJ77
ENSTNIP00000020573 99883.ENSTNIP00000020573 ENSTNIP00000020573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]