SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000001112 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000001112
Domain Number 1 Region: 184-519
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-81
Family Protein kinases, catalytic subunit 0.000000608
Further Details:      
 
Domain Number 2 Region: 30-181
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.24e-42
Family Regulator of G-protein signaling, RGS 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000001112
Sequence length 574
Comment (Mus musculus)
Sequence
MELENFVANNLLLKARLGFNKQTGRSKKWRELLKFPPVSMCTELRWSIEKDFSSLCDKQP
IGRLLFRQFCDTKPDLKRCIEFLDAVAEYEVTIEEEQREFGLAIFSRFFKEKSEVPLPEI
PPDIVKECKWNLKQNSPSQNVFEECAGIVCKYLSETPFEEYQESTYFNRFLQWKWLERRP
VTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKGEAMALNEKRILEK
LHSRFVVSLAYTYETKDALCLVLTIMNGGDLKYHIYNLGDPGFEEPRAVFYAAELCCGLE
DLQRKRIVYRDLKPENILLDDHGHIRISDLGLAMEVPEGEMVRGRVGTVGYMAPEIINHE
KYTFSPDWWGLGCLIYEMIAGHSPFRKYKEKVNREELERRVKNETEEYSERFSEDAKSIC
SMLLIKDPSKRLGCQRDGVSAVKQHPIFKDINFSRLEANMLDPPFIPDPQAIYCRNILDI
GQFSVVKGVNLDTNDEIFYAEFATGSVTIPWQNEMIESGCFKDLNENEDDLSSLEKYKMC
SSILRPKRNFFRRLFRRTGCLNIALSEEREPTEH
Download sequence
Identical sequences O70291
NP_062370.2.92730 ENSMUSP00000001112 10090.ENSMUSP00000001112 ENSMUSP00000001112 ENSMUSP00000001112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]