SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000004959 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000004959
Domain Number 1 Region: 29-140
Classification Level Classification E-value
Superfamily SH2 domain 9.96e-32
Family SH2 domain 0.0000298
Further Details:      
 
Domain Number 2 Region: 155-215
Classification Level Classification E-value
Superfamily SH3-domain 3.41e-22
Family SH3-domain 0.00041
Further Details:      
 
Domain Number 3 Region: 4-41
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000372
Family SH3-domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000004959
Sequence length 217
Comment (Mus musculus)
Sequence
MESVALYSFQATESDELAFNKGDTLKILNMEDDQNWYKAELRGAEGFVPKNYIRVKPHPW
YSGRISRQLAEETLMKRNHLGAFLIRESESSPGEFSVSVNYGDQVQHFKVLREASGKYFL
WEEKFNSLNELVDFYRTTTIAKRRQIFLCDEQPLIKPSRACFAQAQFDFSAQDPSQLSLR
RGDIVEVVEREDPHWWRGRAGGRLGFFPRSYVQPVHL
Download sequence
Identical sequences Q9CX99
ENSMUSP00000004959 ENSMUSP00000004959 ENSMUSP00000004959 10090.ENSMUSP00000004959 NP_082093.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]