SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000005188 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000005188
Domain Number 1 Region: 171-304
Classification Level Classification E-value
Superfamily PH domain-like 4.35e-40
Family Pleckstrin-homology domain (PH domain) 0.000000721
Further Details:      
 
Domain Number 2 Region: 406-512
Classification Level Classification E-value
Superfamily SH2 domain 4.17e-23
Family SH2 domain 0.0000033
Further Details:      
 
Domain Number 3 Region: 16-75
Classification Level Classification E-value
Superfamily Phenylalanine zipper 8.63e-22
Family Adapter protein APS, dimerisation domain 0.00003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000005188
Sequence length 621
Comment (Mus musculus)
Sequence
MNGATPSSAAAPAPVPDWRQFCELHAQVAAVDFAHKFCRFLRDNPTYDTPDAGTSFSRHF
AANFLAVFSEEVRRVLGSAADTMEPEPAVTSVTSALKTATYGHSRSSEDVSAHAATKARV
RKGFSLRNMSLCVVDGVRDLWHRRSSPEPDGGATPKAAEPASEPRDKWTRRLRLARTLAA
KVELVDIQREGALRFMVADDAASGPGGTAQWQKCRLLLRRAVAGERFRLEFFVPPKASRP
KVSIPLSAIIEVRTTMPLEMPEKDNTFVLKVENGAEYILETIDSLQKHSWVADIQGCVDP
GDSEEDTGLSCARGGCLASRVASCSCELLTDADMPRPPETTTAVGAVVTAPHGRARDTVG
ESLAHVPLETFLQTLESSGGVSENNNPGDEGAELDTDAEAELELSDYPWFHGTLSRVKAA
QLVLAGGPRSHGLFVIRQSETRPGECVLTFNFQGKAKHLRLSLNGHGQCHVQHLWFQSVF
DMLRHFHTHPIPLESGGSADITLRSYVRAQGPPPDPGPAPNTAAPVPACWTEPAGQHYFS
SLATATCPPASPSNGAGASSSSGSSSSATSLPPRPAEGPLSAHSRSNSTEHLLDAASGAT
EEPTEATLGRARAVENQYSFY
Download sequence
Identical sequences Q9JID9
ENSMUSP00000005188 ENSMUSP00000005188 ENSMUSP00000005188 10090.ENSMUSP00000005188 NP_001289867.1.92730 NP_061295.2.92730 XP_006504483.2.92730 XP_006504485.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]