SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000005950 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000005950
Domain Number 1 Region: 281-473
Classification Level Classification E-value
Superfamily Hemopexin-like domain 6.54e-60
Family Hemopexin-like domain 0.00000544
Further Details:      
 
Domain Number 2 Region: 107-269
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.45e-57
Family Matrix metalloproteases, catalytic domain 0.00000131
Further Details:      
 
Domain Number 3 Region: 29-101
Classification Level Classification E-value
Superfamily PGBD-like 1.02e-18
Family MMP N-terminal domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000005950
Sequence length 473
Comment (Mus musculus)
Sequence
MSCTLLKGVCTMKFLMMIVFLQVSACGAAPMNDSEFAEWYLSRFYDYGKDRIPMTKTKTN
RNFLKEKLQEMQQFFGLEATGQLDNSTLAIMHIPRCGVPDVQHLRAVPQRSRWMKRYLTY
RIYNYTPDMKREDVDYIFQKAFQVWSDVTPLRFRKLHKDEADIMILFAFGAHGDFNYFDG
KGGTLAHAFYPGPGIQGDAHFDEAETWTKSFQGTNLFLVAVHELGHSLGLQHSNNPKSIM
YPTYRYLNPSTFRLSADDIRNIQSLYGAPVKPPSLTKPSSPPSTFCHQSLSFDAVTTVGE
KIFFFKDWFFWWKLPGSPATNITSISSIWPSIPSGIQAAYEIESRNQLFLFKDEKYWLIN
NLVPEPHYPRSIYSLGFSASVKKVDAAVFDPLRQKVYFFVDKHYWRYDVRQELMDPAYPK
LISTHFPGIKPKIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLKSTSWFGC
Download sequence
Identical sequences P34960
ENSMUSP00000005950 10090.ENSMUSP00000005950 ENSMUSP00000005950 NP_032631.3.92730 ENSMUSP00000114129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]