SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000019701 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000019701
Domain Number 1 Region: 267-414
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.16e-44
Family Dual specificity phosphatase-like 0.000000976
Further Details:      
 
Domain Number 2 Region: 5-93,172-208
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.00000000000000135
Family Cell cycle control phosphatase, catalytic domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000019701
Sequence length 452
Comment (Mus musculus)
Sequence
MESLSRSCLWLRQELSSPRPQLLLLDCRSRELYESARICGALSVALPSLMLRRLRRGSMS
VRSLLPGPPLQPPPPAPVLLYDQGSSGQCHREAAEAEAKAEPKAEAEAEPKAEAEAEPKA
EAENEAEAKAEAKAEAKAEAKAEAKAEAKAEAKAEAKAEAKAEAKEEWDADSVLGVLLQK
LREEGYPAYYLQGGFSKFQAECPHLCETSFSGRAGSGLGSMSSPVPVVGLGGLCLSSDFS
DAESEADRDTLSCGLDSENTTSPPAGLLPPFPVQILPNLYLGSARDSANLESLAKLGIRY
ILNVTPNLPNLFEKNGDFHYKQIPISDHWSQNLSQFFPEAIAFIDEALSQNCGVLVHCLA
GVSRSVTVTVAYLMQKLHLSLNDAYDLVKRKKSNISPNFNFMGQLLDFERSLRLGGKRSG
GRGSGGPESTVSDPPSFFTTPTSDGVFELDPT
Download sequence
Identical sequences Q7TNL7
NP_083628.3.92730 ENSMUSP00000019701 10090.ENSMUSP00000019701 ENSMUSP00000019701 ENSMUSP00000019701 NYSGXRC-8638b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]