SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000020169 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000020169
Domain Number 1 Region: 147-524
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 1.28e-93
Family Phosphonoacetate hydrolase 0.056
Further Details:      
 
Domain Number 2 Region: 616-855
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 5.89e-23
Family DNA/RNA non-specific endonuclease 0.014
Further Details:      
 
Domain Number 3 Region: 51-99
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000248
Family Somatomedin B domain 0.004
Further Details:      
 
Domain Number 4 Region: 100-141
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000248
Family Somatomedin B domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000020169
Sequence length 874
Comment (Mus musculus)
Sequence
MDSRLALATEEPIKKDSLKKYKILCVVLLALLVIVSLGLGLGLGLRKPEEQGSCRKKCFD
SSHRGLEGCRCDSGCTGRGDCCWDFEDTCVKSTQIWTCNLFRCGENRLETALCSCADDCL
QRKDCCADYKTVCQGESPWVTEACASSQEPQCPPGFDLPPVILFSMDGFRAEYLQTWSTL
LPNINKLKTCGIHSKYMRAMYPTKTFPNHYTIVTGLYPESHGIIDNNMYDVHLNKNFSLS
SVEKSNPAWWSGQPIWLTAMYQGLKAACYYWPGSDVAVNGSFPTIYRNYSNSVPYERRIT
TLLQWLDLPKADRPSFYTIYVEEPDSAGHSSGPVSAGVIKALQSVDNAFGMLMEGLKQRN
LHNCVNIIVLADHGMDQTSCDRVEYMTDYFPKINFYMYQGPAPRIRTRNIPQDFFTFNSE
EIVRNLSCRKPDQHFKPYLTPDLPKRLHYAKNVRIDKAHLMVDRQWLAFRSKGSSNCGGG
THGYNNEFKSMEAIFLAHGPSFIEKTVIEPFENIEVYNLLCDLLHIEPAPNNGTHGSLNH
LLKTPFYKPSHAGELSTPADCGFTTPLPTDPLDCSCPALQNTPGLEEQANQRLNLSEGEV
AATVKANLPFGRPRVMQKNGDHCLLYHRDYISGYGKAMKMPMWSSYTVLKPGDTSSLPPT
VPDCLRADVRVAPSESQKCSFYLADKNITHGFLYPAIKGTNESRYDALITSNLVPMYKEF
KKMWDYFHEVLLIKYAIERNGLNVVSGPIFDYNYDGHFDAPDEITQYVAGTDVPIPTHYF
VVLTSCKDQTHTPDSCPGWLDVLPFIVPHRPTNIESCSENKTEDLWVEERFQAHAARVRD
VELLTGLDFYQEKAQPVSQILQLKTYLPTFETII
Download sequence
Identical sequences Q6DYE8
10090.ENSMUSP00000020169 NP_598766.2.92730 ENSMUSP00000020169 ENSMUSP00000020169 ENSMUSP00000020169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]