SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000023105 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000023105
Domain Number 1 Region: 179-448
Classification Level Classification E-value
Superfamily EndoU-like 4.71e-95
Family Eukaryotic EndoU ribonuclease 0.0000087
Further Details:      
 
Domain Number 2 Region: 129-169
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000000484
Family Somatomedin B domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000023105
Sequence length 454
Comment (Mus musculus)
Sequence
MLNCSIHVGQLKLVFNPEGAPLSLPFFTYFSFYIFWVQWAPNARMVENLSPGEIIFVLFC
LSFPSSDLGKPSIFSVLSLLCQIGGWDGMCEYPFNTCACLQAEEGPPEPEAFLDPEDKIP
TSHLYSAPSSCQGRCREAYDKHHPCHCNDRCPEFGNCCEDFDSLCGGDHEGFSHSSDAVT
KEELESISETIYRVDTNKAQKEDIVLNSQNRISPSETGNQVDRSPEPLFTYVNEKLFSKP
TYAAFINLLNNYQRATGHGEHFSAQQLEEQGVFLREVMKTAVMKELYSFLHHQNRYSSEQ
EFVDDLKNMWFGLYSRGNDEGDSSGFEHVFSGEVKKGKVTGFHNWIRFYLQEKEGLLDYY
SHNYDGPWDSYPDVLAMQFNWDGYYKEVGSVFIGSSPEFEFALYSLCFITRPGKKCHLSL
GGYPLAIQTYTWDKTTYGNGKKYIATAYVVSSSQ
Download sequence
Identical sequences ENSMUSP00000023105 NP_032928.1.92730 ENSMUSP00000097820 ENSMUSP00000023105 10090.ENSMUSP00000023105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]