SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000025740 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000025740
Domain Number 1 Region: 6-128
Classification Level Classification E-value
Superfamily DNA clamp 2.44e-18
Family DNA polymerase processivity factor 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000025740
Sequence length 389
Comment (Mus musculus)
Sequence
MKCLITGGNVKVLGKAVHSLSRIGDELYLEPLKDGLSLRTVNSSRSAYACFLFAPLFFQQ
YQAASPGQDLLRCKILMKAFLSVFRSLAIVEKSVEKCCISLSGSHSHLVVQLHCKYGVKK
THNLSFQDCESLQAVFDPASCPHLLRTPARVLAEAVLSFPLALTEVTLGIGRGRRVILRS
YQEEEADSTSKAMVTETSIGDEDFQQLHAPEGIAVTFCLKEFRGLLSFAESANLPLTIHF
DVPGRPVIFTIEDSLLDAHFVLATLLEQDSCSQGPCSPKPHQPVPQKQAHSTPHLDDFTS
DDIDCYMIAMETTGGNEGSGAQPSTSLPPVSLASHDLAPTSEEEAEPSTVPGTPPPKKFR
SLFFGSILAPVHSPQGPNPVLAEDSDGEG
Download sequence
Identical sequences Q9Z0F6
NP_035367.1.92730 ENSMUSP00000025740 ENSMUSP00000025740 10090.ENSMUSP00000025740 ENSMUSP00000025740 ENSMUSP00000137976 MmR256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]