SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000027991 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000027991
Domain Number 1 Region: 52-179
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.01e-46
Family Regulator of G-protein signaling, RGS 0.000000232
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000027991
Sequence length 205
Comment (Mus musculus)
Sequence
MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHSSSHSKKDKVVTCQRVSQEEVKKWA
ESLENLIHHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFIS
VQATKEVNLDSCTREETSRNMLQPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLTNP
SSCGAEKQKGAKSSADCTSLVSQCA
Download sequence
Identical sequences Q5D078
ENSMUSP00000027991 10090.ENSMUSP00000027991 ENSMUSP00000027991 ENSMUSP00000027991 NP_033088.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]