SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000028681 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000028681
Domain Number 1 Region: 333-615
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.56e-88
Family Eukaryotic proteases 0.00000000117
Further Details:      
 
Domain Number 2 Region: 101-196
Classification Level Classification E-value
Superfamily Kringle-like 6.04e-31
Family Kringle modules 0.0000142
Further Details:      
 
Domain Number 3 Region: 211-297
Classification Level Classification E-value
Superfamily Kringle-like 2.9e-26
Family Kringle modules 0.0000415
Further Details:      
 
Domain Number 4 Region: 45-105
Classification Level Classification E-value
Superfamily GLA-domain 1.43e-19
Family GLA-domain 0.0000951
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000028681
Sequence length 618
Comment (Mus musculus)
Sequence
MSHVRGLGLPGCLALAALVSLVHSQHVFLAPQQALSLLQRVRRANSGFLEELRKGNLERE
CVEEQCSYEEAFEALESPQDTDVFWAKYTVCDSVRKPRETFMDCLEGRCAMDLGVNYLGT
VNVTHTGIQCQLWRSRYPHKPEINSTTHPGADLKENFCRNPDSSTTGPWCYTTDPTVRRE
ECSVPVCGQEGRTTVVMTPRSGGSKDNLSPPLGQCLTERGRLYQGNLAVTTLGSPCLPWN
SLPAKTLSKYQDFDPEVKLVENFCRNPDWDEEGAWCYVAGQPGDFEYCNLNYCEEAVGEE
NYDVDESIAGRTTDAEFHTFFNEKTFGLGEADCGLRPLFEKKSLKDTTEKELLDSYIDGR
IVEGWDAEKGIAPWQVMLFRKSPQELLCGASLISDRWVLTAAHCILYPPWDKNFTENDLL
VRIGKHSRTRYERNVEKISMLEKIYVHPRYNWRENLDRDIALLKLKKPVPFSDYIHPVCL
PDKQTVTSLLRAGYKGRVTGWGNLRETWTTNINEIQPSVLQVVNLPIVERPVCKASTRIR
ITDNMFCAGFKVNDTKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRKGKYGFY
THVFRLKRWIQKVIDQFG
Download sequence
Identical sequences P19221 Q3TJ94
ENSMUSP00000106967 NP_034298.1.92730 ENSMUSP00000028681 10090.ENSMUSP00000028681 ENSMUSP00000028681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]