SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000029141 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000029141
Domain Number 1 Region: 346-542
Classification Level Classification E-value
Superfamily Hemopexin-like domain 8.77e-69
Family Hemopexin-like domain 0.00000746
Further Details:      
 
Domain Number 2 Region: 134-300
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 8.42e-57
Family Matrix metalloproteases, catalytic domain 0.000000107
Further Details:      
 
Domain Number 3 Region: 49-117
Classification Level Classification E-value
Superfamily PGBD-like 8.63e-20
Family MMP N-terminal domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000029141
Sequence length 618
Comment (Mus musculus)
Sequence
MPRSRGGRAAPGQASRWSGWRAPGRLLPLLPALCCLAAAAGAGKPAGADAPFAGQNWLKS
YGYLLPYESRASALHSGKALQSAVSTMQQFYGIPVTGVLDQTTIEWMKKPRCGVPDHPHL
SRRRRNKRYALTGQKWRQKHITYSIHNYTPKVGELDTRKAIRQAFDVWQKVTPLTFEEVP
YHEIKSDRKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLG
NANHDGNDLFLVAVHELGHALGLEHSNDPSAIMAPFYQYMETHNFKLPQDDLQGIQKIYG
PPAEPLEPTRPLPTLPVRRIHSPSERKHERHPRPPRPPLGDRPSTPGAKPNICDGNFNTV
ALFRGEMFVFKDRWFWRLRNNRVQEGYPMQIEQFWKGLPARIDAAYERADGRFVFFKGDK
YWVFKEVTVEPGYPHSLGELGSCLPREGIDTALRWEPVGKTYFFKGERYWRYSEERRATD
PGYPKPITVWKGIPQAPQGAFISKEGYYTYFYKGRDYWKFDNQKLSVEPGYPRNILRDWM
GCKQKEVERRKERRLPQDDVDIMVTIDDVPGSVNAVAVVVPCTLSLCLLVLLYTIFQFKN
KAGPQPVTYYKRPVQEWV
Download sequence
Identical sequences Q9R0S2
ENSMUSP00000029141 ENSMUSP00000029141 NP_034938.3.92730 ENSMUSP00000029141 10090.ENSMUSP00000029141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]