SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000032648 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000032648
Domain Number 1 Region: 70-170
Classification Level Classification E-value
Superfamily Ras GEF 0.00000000000000131
Family Ras GEF 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000032648
Sequence length 214
Comment (Mus musculus)
Sequence
MFRCFQTCRGSGHKKAKSSWLGCFWRRLIRPLTHLRHASRSEPKVCCENEQEPDSMSNHP
RFDYKSREYIQQMIDYIPAAIQNRDHLCLDIFVAMYRTYATTWEVLDLLMKTYASFRTDC
IEDQQTKSAIFSFLFGWFQKFPQDFYESPDLAVLSQFTEYVRLNVPFGDGDTQAREPLSM
FKDQEAITLRLEEGEKVWCWLLDKVGGGFGDGFH
Download sequence
Identical sequences Q9D420
ENSMUSP00000032648 ENSMUSP00000032648 ENSMUSP00000032648 NP_081978.1.92730 10090.ENSMUSP00000032648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]