SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000033822 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000033822
Domain Number 1 Region: 137-399
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.37e-34
Family Eukaryotic proteases 0.0006
Further Details:      
 
Domain Number 2 Region: 43-104
Classification Level Classification E-value
Superfamily GLA-domain 1.23e-23
Family GLA-domain 0.00048
Further Details:      
 
Domain Number 3 Region: 93-129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000963
Family EGF-type module 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000033822
Sequence length 399
Comment (Mus musculus)
Sequence
MAGCILLLRGFILTLILHQVELSVFLPAPKANNVLRRWRRGSSYFLEEIFQGNLEKECYE
EVCNYEEAREVFENDVITDEFWRQYGGGSPCVSQPCLNNGTCEDHIRSYSCTCSPGYEGK
TCAMAKNECHLERTDGCQHFCHPGQSSYMCSCAKGYKLGKDQKSCGPSDKCACGALTSEH
IRMTKSSQSQPSFPWQVRLTNSEGEDFCAGVLLQEDFVLTTAKCSLLHSNISVKANVDQR
IRIKSTHVHMRYDEESGENDVSLLQLEEPLQCPSSGLPVCVPERDFAEHVLIPGTEGLLS
GWMLNGTHLATTPMLLSVTQADGEECGQTLNVTVTTRTSCEKGSVVMGPWVEGSVVTREH
KGTWFLTGILGSPPPPGQSQMLLLTAVPRYSMWFKQIMK
Download sequence
Identical sequences Q9CQW3
NP_080110.1.92730 10090.ENSMUSP00000033822 ENSMUSP00000033822 ENSMUSP00000033822 ENSMUSP00000033822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]