SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000034359 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000034359
Domain Number 1 Region: 8-165
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 2.88e-66
Family TRADD, N-terminal domain 0.000000451
Further Details:      
 
Domain Number 2 Region: 217-307
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000000443
Family DEATH domain, DD 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000034359
Sequence length 310
Comment (Mus musculus)
Sequence
MAAGQNGHEEWVGSAYLFLESAVDKVILSEAYTDPKKKVAIYKALQTALSESGDSSDVLQ
ILKIHCSDPQLIVQLRFCGRVLCGRFLQAYREGALRTALQRCMAPALAQEALRLQLELRA
GAEQLDSWLTDEERCLNYILAQKPDRLRDEELAELEDELCKLTCDCTGQGGAIQVASAGS
KFPVSSPTEEKPLPAACQTFLFHGQLVVNRPLTLQDQQTFARSVGLKWRRVGRSLQRNCR
ALRDPALDSLAYEYERDGLYEQAFQLLRRFMQAEGRRATLQRLVEALEENELTSLAEDLL
GQAEPDGGLA
Download sequence
Identical sequences B2RRZ7 Q3U0V2
ENSMUSP00000034359 ENSMUSP00000034359 ENSMUSP00000034359 NP_001028333.1.92730 10090.ENSMUSP00000034359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]