SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000034524 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000034524
Domain Number 1 Region: 41-216
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.21e-44
Family DnaQ-like 3'-5' exonuclease 0.00000283
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000034524
Sequence length 237
Comment (Mus musculus)
Sequence
MLGVSLGARLLRGVGGRRGQFGARGVSEGSAAMAAGESMAQRMVWVDLEMTGLDIEKDQI
IEMACLITDSDLNILAEGPNLIIKQPDELLDSMSDWCKEHHGKSGLTKAVKESTVTLQQA
EYEFLSFVRQQTPPGLCPLAGNSVHADKKFLDKHMPQFMKHLHYRIIDVSTVKELCRRWY
PEDYEFAPKKAASHRALDDISESIKELQFYRNNIFKKKTDEKKRKIIENGETEKPVS
Download sequence
Identical sequences Q9D8S4
ENSMUSP00000034524 ENSMUSP00000034524 NP_077195.2.92730 XP_021062408.1.100879 ENSMUSP00000034524 10090.ENSMUSP00000034524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]