SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000040975 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  10090.ENSMUSP00000040975
Domain Number - Region: 6-46
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.00188
Family AN1-like Zinc finger 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000040975
Sequence length 154
Comment (Mus musculus)
Sequence
MSATRAKKVKMATKSCPECDQQIPVACKSCPCGYIFISRKLLNAKHSEKSPPSTENKHEA
KRRRTERVRREKINSTVNKDLENRKRSRSNSHSDHIRRGRGRPKSSSAKKHEEEREKQEK
EIDIYANLSDEKAFVFSVALAEINRKIINQRLIL
Download sequence
Identical sequences B2RZC8 Q9CR55
ENSRNOP00000023169 ENSMUSP00000040975 ENSRNOP00000023169 ENSMUSP00000040975 NP_001127893.1.100692 NP_001127893.1.4139 NP_079998.1.92730 ENSMUSP00000040975 10090.ENSMUSP00000040975 10116.ENSRNOP00000023169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]