SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000043146 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000043146
Domain Number 1 Region: 157-347
Classification Level Classification E-value
Superfamily PH domain-like 9.99e-59
Family Phosphotyrosine-binding domain (PTB) 0.000000407
Further Details:      
 
Domain Number 2 Region: 510-614
Classification Level Classification E-value
Superfamily SH2 domain 1.62e-24
Family SH2 domain 0.0000263
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000043146
Sequence length 626
Comment (Mus musculus)
Sequence
MRERSQDSQAGLTLYVGLFGHLGMLHRTKYSRFRNESITSLDEGSPGGSVGNKGSSPPPY
PALAPHLPTEDATVSSQESPTALCTLIPRMASMKLANPITFLGLKTFCLGTKQVSRLKLQ
ENQDQTPSRPASPESNLNRTGPAPAPDPDQVGRRPTSLRPDTCPLPGPGEPSPRSKQDGP
PLQHLLGNGLNYCVRYMGCIEVLQSMRSLDFGMRTQVTREAISRLCEAVPGAHGAIKKRK
APVKFLTTVLGKSNLQFSGMNIKLTVSTSSLTLMNLDNQQIIANHQMQSISFASGGDPDT
TDYVAYVAKDPVNQRACHILECRSGMAQDVISTIGQAFELRFKQYLKNPSLNTWEREEVL
VDGAPEDRDHDYYNSIPGKQPPEGGISDVRIQAQATDQMAYCPIRCEKLCYLPGNSTCSG
VYKNCMGRSRPIGIPHERAGQGDTPSLRHFWRVDLFDDPCYVNTQALQSMHSYAGNQSSA
LPQGSPWHLGKAPETVQPGATAKPGSALALPHIRQQLWDEECFHGKLSRGAAEKLLVKDG
DFLVRESVTSPGQFVLSGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIKYHMDNNLPI
ISSGSEVRLKQPIRKYDNTGLLPPKK
Download sequence
Identical sequences Q6S5L9
ENSMUSP00000043146 ENSMUSP00000043146 NP_950187.1.92730 10090.ENSMUSP00000043146 ENSMUSP00000043146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]