SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000043733 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000043733
Domain Number 1 Region: 17-90,120-253
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 2.62e-34
Family Leukotriene A4 hydrolase N-terminal domain 0.0023
Further Details:      
 
Domain Number 2 Region: 263-528
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00000000000000366
Family Leukotriene A4 hydrolase catalytic domain 0.033
Further Details:      
 
Domain Number 3 Region: 692-985
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000072
Family Clathrin adaptor core protein 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000043733
Sequence length 1198
Comment (Mus musculus)
Sequence
MPPTGLESSRMNRKKGDKGFESPRPYKLTHQVVCINNINFQRKSVVGFVELTIFPTVANL
NRIKLNSKQCRIYRVRINDLEAAFIYNDPTLEVCHSESKQRNLNYFSNAYAAAVSAVDPD
AGNGELCIKVPSELWKHVDELKVLKIHINFSLDQPKGGLHFVVPSVEGSMAERGAHVFSC
GYQNSTRFWFPCVDSYSELCTWKLEFTVDAAMVAVSNGDLVETVYTHDMRKKTFHYMLTI
PTAASNISLAIGPFEILVDPYMHEVTHFCLPQLLPLLKHTTSYIHEVFEFYEEILTCRYP
YSCFKTVFIDEAYVEVAAYASMSIFSTNLLHSAMIIDETPLTRRCLAQALAQQFFGCFIS
RMSWSDEWVLKGISGYIYGLWMKKTFGVNEYHHWIKEELDKIVAYELKTGGVLLHPIFGG
GKEKDNPASHLHFSIKHPHTLSWEYYTMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLA
STASSQKFQSHMWSQMLVSTYGFLKSISNVSGKDIQPLIKQWVDQSGVVKFYGSFAFNRK
RNVLELEIKQDYTSPGTQKYVGPLKVTVQELDGSFNHTLQIEENSLKHDIPCHSKSRRNK
KKKIPLMNGEEVDMDLSAMDADSPLLWIRIDPDMSVLRKVEFEQADFMWQYELRYERDVV
AQQESILALEKFPTPASRLALTDILEQEQCFYRVRMSACFCLAKIANSMVSTWTGPPAMK
SLFTRMFCCKTCPNIVKTNNFMSFQSYFLQKTMPVAMALLRDVHNLCPKEVLTFILDLIK
YNDNRKNKFSDNYYRAEMIDALANSVTPAVSVNNEVRTLDNLNPDVRLILEEITRFLNME
KLLPSYRHTITVSCLRAIRVLQKNGHVPSDASLFKSYAEYGHFVDIRIAALEAVVDYTKV
DRSYEELQWLLNMIQTDPVPYVRHKILNMLTKNPPFTKNMESPLCNEALVDQLWKLMNSG
TAHDWRLRCGAVDLYFTLFGLSRPSCLPLPELGLVLNLKEKKAVLNPTIIPEAGVGNQES
ASNPGCHAQLAGFQNPFSSSQDEEEVDMDTVHDSQAFISHHLNMLERPSTPGLSKYRPSG
SRSSLMPQHSLGCDITPPTKPQWSMELSRKGAGKEQPLEMGVHSMVAAPLSMFAKEALSS
RHSEHHHHHHHEHKKKKKKHKHKHKHKHKHDSKDKDREPFAFSSPASGRSVRSPSLSD
Download sequence
Identical sequences B9EJX5
ENSMUSP00000043733 NP_001074757.1.92730 ENSMUSP00000043733 ENSMUSP00000043733 10090.ENSMUSP00000043733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]