SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000046502 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000046502
Domain Number 1 Region: 104-193,232-488
Classification Level Classification E-value
Superfamily MFS general substrate transporter 6.93e-30
Family Glycerol-3-phosphate transporter 0.048
Further Details:      
 
Domain Number 2 Region: 494-539
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000025
Family Ovomucoid domain III-like 0.013
Further Details:      
 
Domain Number 3 Region: 577-689
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0000471
Family Glycerol-3-phosphate transporter 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000046502
Sequence length 723
Comment (Mus musculus)
Sequence
MPQHAMGDTHFLSLPKHLFTSTSSATDSGCDTPPSSRASPASLRSAHGTLGSSSQPLFEP
QAEKRSSQTAREVQYVSSGPQNSLCGWQAFTPKCLQVFNTPKGFLFFLCAASFLQGMTVN
GFINTVITSIERRFDLHSYQSGLIASSYDIAACLCLTFVSYFGGNGHKPRWLGWGVLVLG
IGSLVFALPHFTAGRYEVEMDEGLGTGTCLTNQSHVECKDSASGLSNYRLIFMLGQLLHG
VGATPLYTLGVTYLDENVKSSYSPIYIAIFYTAAILGPAAGYLIGGAMLNVYTEVGQRTE
LTTDSPLWVGAWWIGFLGTGIAAFLIAIPILGYPRQLPGSQRYVVMRAAETQQLKDHSRG
AVSNPAFGKTVRDLPLSIWLLLRNPTFILLCLAGATEATLIAGMSTFGPKFFEAQFSLSA
SEAATLFGYLVVPAGGGGTLLGGFLVNKFKLRGSGIIRFCLFCTLTSLLAFFVFLMHCPN
VHMAGVTTGYVGSLLPKGQLDLKAACNAIYCCQPKHYSPLCGSDGTMYYSPCYAGCPADA
ETDLGGQKVYRGCSCILEKASSGWGNATAGKCASTCQSKPFLLVLVFVVIIFTFLSSIPA
LTATLRCVSDRQRSFALGIQWIVVRTLGSIPGPIAFGWVIDKACLLWQDQCGHQGSCFVY
ENEAMSRYMLIAGLTFKVLGFLFFVAAYFLYKSPSVSSDGLEASLPSQSSASDSPTEQLQ
SNV
Download sequence
Identical sequences Q8K078
NP_683735.1.92730 XP_006500610.1.92730 10090.ENSMUSP00000046502 ENSMUSP00000045023 ENSMUSP00000045023 ENSMUSP00000046502 ENSMUSP00000045023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]