SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000046856 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000046856
Domain Number 1 Region: 318-727
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.26e-119
Family Terpene synthases 0.0000000000119
Further Details:      
 
Domain Number 2 Region: 101-379
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 6.43e-97
Family Terpene synthases 0.000000000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000046856
Sequence length 733
Comment (Mus musculus)
Sequence
MTEGTCLRRRGGPYKTEPATDLTRWRLQNELGRQRWTYYQAEDDPGREQTGLEAHSLGLD
TRSYFTDLPKAQTAHEGALNGVTFYAKLQAEDGHWAGDYGGPLFLLPGLLITCHISHISL
PAGYREEMVRYLRSVQLPDGGWGLHIEDKSTVFGTALNYVALRILGIGPDDPDLVRARNV
LHKKGGAVAIPSWGKFWLAVLNVYSWEGLNTLFPEMWLFPEWVPAHPSTLWCHCRQVYLP
MSYCYATRLSASEDPLVQSLRQELYVQDYASIDWPAQRNNVSPDEMYTPHSWLLHVVYGL
LNLYERFHSTSLRKWAVQMLYEHIAADDCFTKCISIGPISKTINMLVRWSVDGPSSPAFQ
EHVSRIKDYLWLGLDGMKMQGTNGSQIWDTSFAIQALLEAGAHHRPEFLPCLQKAHEFLR
LSQVPENCPDYQKYYRHMRKGGFSFSTLDCGWIVADCTAEGLKAVLLLQNQCPSITEHIP
RERLCDAVDVLLSLRNADGGFATYEKKRGGYLLELLNPSEVFGDIMIDYTYVECTSAVMQ
ALKHFHEHFPDYRAAEVRETLNQGLDFCRRKQRADGSWEGSWGVCFTYGTWFGLEAFACM
GHTYQDGAACAEVAQACNFLLSQQMADGGWGEDFESCEQRRYVQSARSQVHSTCWALMGL
MAVRHPDITAQERGIRCLLGKQLPNGDWPQENISGVFNKSCAISYTSYRNIFPIWALGRF
SNLYPDNTLAGHI
Download sequence
Identical sequences Q8BLN5
ENSMUSP00000046856 ENSMUSP00000046856 10090.ENSMUSP00000046856 ENSMUSP00000046856 NP_666118.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]