SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000052661 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000052661
Domain Number 1 Region: 184-376
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2e-37
Family Reprolysin-like 0.00081
Further Details:      
 
Domain Number 2 Region: 397-473
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 1.15e-16
Family Blood coagulation inhibitor (disintegrin) 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000052661
Sequence length 771
Comment (Mus musculus)
Sequence
MFLLLLLFLHLKGLQAGQNPQKTTLQTTVPEKISSPDVETDAEDHMAYLITINETPHFIH
LKKQSFITPTAVVYTYDRNDVQHSQPLSALENCNYNGYVAGFPNSIVTLTVCTGLRGIIQ
FENVSYAIEPVETLSGFVHVIYENTNKHAVIPDLGKNQSYSWFDESDYQFRSNMKKSGFT
VLRQRFIMMDIIVDKKLFDYMGSDTEVVLQKVIQIIGFVNTMLSKLKLTVLINSIEIWSK
ENRIRLSKAVDDLLVQFSIWKHEYRSQHVAYLLAFEEHPASTGALYPGNLCKLEYNAAVA
LYPKGLSLESFSVIVLQLLSIGMGLTYDTENCHCTGEVCLMTPKAIYSGGVKDFSTCTLD
DFKYLSTRQDLRCLQDLPLERKPARRPRRICGNGILEMNEQCDCGTLKNCTHRKCCDPMS
CRLKNKATCGSGECCSQDCTVKMNDVVCRKSVDECDFVEYCNGKDPYCVPNTYARNGQYC
ESGEAFCFEGRCQTADKQCMSMLGKYVRGASFACYEEFNSRGDRFGNCIHNFCAFRNSLC
GKLICTWPFKKLVLKANLSVAYAQIRDDLCVAMYKGGRIPKTTKTTYSNPADRDETFVND
GTICGPDMFCLRASCTETRFHMDSSKCDSTRDCNDHGVCNNLQHCHCDIGYNPPFCEEHK
GQFGSVDDGHKYHVEDGKSYKQQSHSNLKKNQLQLILYISLPLLVMISAVVIKQSKLSRV
CDRERSESDSSTTEDSGSNTNVTSSGGSSSTDPPITPNPERILYVFALKKH
Download sequence
Identical sequences ENSMUSP00000052661 10090.ENSMUSP00000052661 ENSMUSP00000052661 ENSMUSP00000052661 NP_001258987.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]