SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000053146 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  10090.ENSMUSP00000053146
Domain Number - Region: 90-126
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0774
Family C1-like domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000053146
Sequence length 293
Comment (Mus musculus)
Sequence
MAQEKPGCSNPVPNGDCPIIEKMEKRTCALCPEGHEWSQIYFSPSANIVAHENCLLYSSG
LVECEAPDLPNTVRNFDVKSVKKEIGRGRRLKCSFCKNKGATMGYDLQSCTKNYHLSCAM
EDHAILQVDEDHGTYKLFCQKHAPEGQEPTQRDAAVKAPFLKKCQEAGLLNVLLEYILEK
MDLIHGRLLNETASESDYEGIETLLFGCGLFGDTLRKFQEVINSKACEWEERQRLMKQQL
EALADLQQNLCSFQENGDLDCSSSTSGSLLPPEDHQVRCQESPEVQAGSGDSL
Download sequence
Identical sequences Q8BVM9
NP_766191.1.92730 ENSMUSP00000053146 ENSMUSP00000053146 ENSMUSP00000053146 10090.ENSMUSP00000053146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]