SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000055517 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000055517
Domain Number 1 Region: 416-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 360-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.2e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 304-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-23
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 4 Region: 462-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.76e-21
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 5 Region: 239-291
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 44-95
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.22e-16
Family KRAB domain (Kruppel-associated box) 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000055517
Sequence length 519
Comment (Mus musculus)
Sequence
MEEVVIMETGLAEVPQKRALSSPDSLLSHEKSAEGDVAALRLTVRSQEAMTFKDVAMDFT
PEEWGKLDPAHRAVMLENYRNLVSLWLPISKPDNYNSEDGKELSKLEKSPKCSDSDMETR
PESKESTSVLDFSKEESNRLTENTASDSDIETALECERWLEHRQRNRERYPRQMSAHRNS
LPAQEDGERDVYWKSFSQKPLLTTDDRDPKGSWDVHTLGKRLKQKSKLMTKQRPYKEKKP
HKCDECGELFTYRSVLIRHQRVHTGEKPYTCSECGKSFSHRANLTKHQRTHTRILFECGE
CKKTFIESSSLEVHQRIHIGERPYECAECGKGFNRSTHLAQHQLIHTGVKPYECNECDKA
FIHSSALIKHQRTHTGEKPYKCQDCGKAFSHCSSLTKHQRVHTGERPYECSECGKTFSQS
THLVQHQRIHTGEKPYECNECGKTFSRSSNFAKHQRIHMGKKPYKCGECGKAFVHSSALI
QHQRTHTGEKPFRCTECGKSFKSSPSLIRHQRTHTEEQP
Download sequence
Identical sequences Q8C0E6
NP_620399.3.92730 ENSMUSP00000055517 10090.ENSMUSP00000055517 ENSMUSP00000055517 ENSMUSP00000055517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]