SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000058300 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000058300
Domain Number 1 Region: 379-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.68e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 435-492
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.86e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 323-380
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.14e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 267-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.44e-23
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 5 Region: 2-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.37e-22
Family KRAB domain (Kruppel-associated box) 0.00018
Further Details:      
 
Domain Number 6 Region: 477-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.14e-20
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 7 Region: 165-216
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000676
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000058300
Domain Number - Region: 115-162
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000238
Family Classic zinc finger, C2H2 0.038
Further Details:      
 
Domain Number - Region: 204-244
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.036
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000058300
Sequence length 543
Comment (Mus musculus)
Sequence
MDAVTYEDVHVNFSQEEWALLDPSQKSLYKDVMLETYWNLTCIGYKWEDHNIEDQHQSSG
RHGRCINCPSAYGKKQCTNLFPRTIRRRYVVTPFVKRGGECDTSLQVLGFPASVGIHQNT
DTGEKPSVDKESGKSPVCPGSLCTCSVTHSIGECYECSQCGKALSCSLQRHDQTHMGKGS
DKCEPSSKSLTHPRYLQIQKTAYNEEDLYVWNQCGKSSLQPHRRTHLGMKSCEYNHEDKL
ISHQNCNQVGRTNTRDTKHDYHQWGKAFTYPSYLQIYERIHTEEKPYECSQCGRAFTCHS
TLQIHERIHTGEKPYKCNQCGKTFACKRYLQIHEKIHTGEKPYKCNQCGKAFACNSYLQI
HERIHTGEKPYKCSQCGKAFACNSYLQMHERIHTGEKPYKCNQCGKAFACNSNLQKHERT
HTGEKPYKCNQCGKAFTCHSTLQIHERIHTGEKPYKCNQCSKAFARKRYLQIHERIHTGE
KPYECNQCGKAFAYSSSLNKHERTHTAEKPFECNQCGIAFACLSTLQKHEGIHTEKIPQQ
SKK
Download sequence
Identical sequences Q8K0G9
10090.ENSMUSP00000058300 ENSMUSP00000058300 ENSMUSP00000058300 NP_666361.1.92730 ENSMUSP00000058300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]