SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000059426 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000059426
Domain Number 1 Region: 955-1257
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 3.28e-75
Family Complement components 0.0000697
Further Details:      
 
Domain Number 2 Region: 1326-1452
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 3.53e-32
Family Alpha-macroglobulin receptor domain 0.0000901
Further Details:      
 
Domain Number 3 Region: 784-904
Classification Level Classification E-value
Superfamily E set domains 2.8e-16
Family SVA-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000059426
Sequence length 1456
Comment (Mus musculus)
Sequence
MVPTILLSALLLHFTDVVAAEPRYILWVSSVVQRFSSEKACLHLLNLNESVSLSVTLEYD
GSSTTIFDQPVDEGNFYACADFKVSQMSSEQLAFVALLVQGNTLKISERRSVAIAAEENA
TFVQTDTPVHKPGDTVHFRVVTLNIWLKPVDDLYPLITVQDPQSNVIFQWINVTTFRNIT
QLSFQLTPEPILGDYTIVIKTQSGTTVMDHFTVNRDVLPKFEVELTAPETITIADSQFQM
VTCAKYTYGQPVQGKAQIKVCRELFSPAHCESNENEICEQFTVQLKDGCASHIINTKVFQ
LDRSGLFMTLNVNEVVTESGTGVQMSKTHSVFITSVLGTVSFENMDPFYRRGITYFGTLK
FSGPNNTPLVDKLLQLELDGKPVGNYTTDENGEARFSINTSEIFGAQISLKAVYVRPRSC
HRSSWLSPEYLDAYFSASRFYSQTSSFTKIILEPKQLPCDQEKMFSVLYSLNPEAYKEAS
DVTFFYLVMVRGGISRSGQKQVRVQAWNGNFSFPISINADLAPSADLFVYTLHPSGEIVA
DNVRLQIEKCFKNKVSINFSRDKDLPGSNTSVHLQAAPDSFCALRAVDKSALLLNHGQEM
TPESVYFTLPYIHQYGYFYNGLNLDDQQAEPCIPQKDLFYNGLYYTPTGNIWDGDLSNLL
SNMGLKIFTNLHYRKPEVCSSQENQPLLRTFDHPNERIMMYGGGAPPSSAFHDSVDSISH
AKVAIKETVRTNFPRTWIWNLVSVDSSGTANVSFLVPDTITQWEASAFCVNGNAGFGISP
KVSLQISQPFFVEVTSPFSVVRSEQSDMVVTVFNYLTTCVEISVQLEASENYEASINTQR
NTDSEVLQAGEQKTYVWTIIPKTLGKVNVTVVATSKQSRACPNDASKEQDVHWKDTVVKT
MLVEAEGIEKEATQSFLICPKGTKASKQTLLELPSNVVEGSVRSFVTIVGDILGVAMQNL
ESLLQMPYGCGEQNIAQLASDVYILDYLKATDQLTEELKSKAQRLLSNGYQNHLSFKNYD
GSYDVFCQSNQEGSTWLSALSFKTVEKMKEYIFIEETVPKQTLIWLVKKQKSNGCFRRDE
KHVDTAQEGREGDQEDIALTAYVVGVFLEVGLNASFPALRNGLYCLEEAFSNGVTNGYTQ
AILAYVFALAGKEQQAKSLLSILDKSATKTNNMIYWERDEKPETDNSPSFIPSALSGETE
KTCYVLLAVLSQDTQDLDYASKIVQWLAQRMNSHGGFSAMQDTTVCLLALTQYMKLTGSN
PQNTITLSSEESEEVFYVNRNKRLLVQHSKVSKGHQQYTVDVEGDGCSFIQATLRYNVPL
PKEASGFSLSVKTGKSNSSDEFQTKFELTVTLTYTGARESSVTVLVDVKMLSGFTPVVSS
TEELKFNSQVTKTDIKNGHVLFYLENVPKEATSLTFSIEQTNHVANIQPAPVTVYSYEKG
EYAFDSYNINSISDSQ
Download sequence
Identical sequences Q3UU35
ENSMUSP00000059426 NP_001001179.2.92730 ENSMUSP00000059426 10090.ENSMUSP00000059426 ENSMUSP00000059426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]