SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000061935 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000061935
Domain Number 1 Region: 37-139
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.7e-18
Family Thyroglobulin type-1 domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000061935
Sequence length 315
Comment (Mus musculus)
Sequence
MAGPQALAFGLLLAVVTATLAAAQRDCVCDNYKLATSCSLNEYGECQCTSYGTQNTVICS
KLASKCLAMKAEMTHSKSGRRIKPEGAIQNNDGLYDPDCDEQGLFKAKQCNGTATCWCVN
TAGVRRTDKDTEITCSERVRTYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKF
IKNIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGEP
LDLDPGQTLIYYVDEKAPEFSMQGLTAGIIAVIVVVSLAVIAGIVVLVISTRKKSAKYEK
AEIKEMGEIHRELNA
Download sequence
Identical sequences Q99JW5
10090.ENSMUSP00000061935 ENSMUSP00000061935 ENSMUSP00000061935 NP_032558.2.92730 ENSMUSP00000061935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]