SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000062231 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000062231
Domain Number 1 Region: 322-391
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.71e-16
Family SAM (sterile alpha motif) domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000062231
Sequence length 417
Comment (Mus musculus)
Sequence
MASSKLREPVDEVFDLDLAVPETTRLDSSLHKARAQLLAKGRRHRPSRSRLRDSASSAED
GEGSDGPGGKVTDGCGSPLHRLRSPLHSGPGSPASGSFCLEPPGLRRSLDEDEPPPSPLA
RYRPLHNAASHEGLAATSGSPPRSAPSSDSSPSFVRRYPRAEPHSEDDSRDASPPEPASP
TIGLDKKTRRKFLDLGVTLRRASTSRSRKEKGSNRLSMGSRESVEGSGRTGSSPFLPFSW
FTDSGKGSASSGSTTSPTCSPKHEGFSPKKSASQESTLSDDSTPPSSSPKIPGGPRQETK
CSYPYHTLSQSSDEFLDESLPAVQHWTSQQVGQWLHSLNLEQYAAEFAARQVDGPQLLQL
DGSKLKSLGLSNSHDRALVKRKLKELAAAAEKERKAQEKTAKQREKLRRRENDAKKS
Download sequence
Identical sequences Q8K070
10090.ENSMUSP00000062231 ENSMUSP00000062231 ENSMUSP00000062231 ENSMUSP00000062231 NP_666137.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]