SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000063104 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000063104
Domain Number 1 Region: 89-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000385
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 2 Region: 211-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000126
Family EGF-type module 0.007
Further Details:      
 
Domain Number 3 Region: 173-209
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000134
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 4 Region: 130-170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000671
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000063104
Domain Number - Region: 57-93
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000511
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000063104
Sequence length 385
Comment (Mus musculus)
Sequence
MIATGALLRVLLLLLAFGHSTYGAECDPPCDPQYGFCEADNVCRCHVGWEGPLCDKCVTA
PGCVNGVCKEPWQCICKDGWDGKFCEIDVRACTSTPCANNGTCVDLEKGQYECSCTPGFS
GKDCQHKAGPCVINGSPCQHGGACVDDEGQASHASCLCPPGFSGNFCEIVAATNSCTPNP
CENDGVCTDIGGDFRCRCPAGFVDKTCSRPVSNCASGPCQNGGTCLQHTQVSFECLCKPP
FMGPTCAKKRGASPVQVTHLPSGYGLTYRLTPGVHELPVQQPEQHILKVSMKELNKSTPL
LTEGQAICFTILGVLTSLVVLGTVAIVFLNKCETWVSNLRYNHMLRKKKNLLLQYNSGEE
LAVNIIFPEKIDMTTFNKEAGDEEI
Download sequence
Identical sequences Q925U3
10090.ENSMUSP00000063104 ENSMUSP00000063104 ENSMUSP00000063104 NP_034182.2.92730 ENSMUSP00000063104 ENSMUSP00000105470 ENSMUSP00000139257 ENSMUSP00000139382 ENSMUSP00000139391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]