SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000068807 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000068807
Domain Number 1 Region: 469-526
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.32e-25
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 2 Region: 385-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.72e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 3-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-24
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 4 Region: 511-563
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.84e-21
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 5 Region: 432-464
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000732
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 6 Region: 347-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000955
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 7 Region: 221-276
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000975
Family Classic zinc finger, C2H2 0.044
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000068807
Domain Number - Region: 265-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00314
Family Classic zinc finger, C2H2 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000068807
Sequence length 576
Comment (Mus musculus)
Sequence
FNRSQEQVSFKDVCVDFTKEEWYLLDPAQKVLYRDVILENYSNFVSVGHCVTKPDVIFKI
EQGEDPWIPENGFQCHPERKWKVDDLLESNQENQDGHFWPLMFTNKITNLEGGGNTRETP
SPDIDSVSSRSFLLKVCDSCEMNLKNVSAVIISKKNYSRKKLNEFNIHKKPLPDSRREKI
PVGIKSCDYDGERDGVRLCRDLARPVSHQPFEYNETGQGFCEEVALCTSQNSQLGETLYK
HTECGRTFVDSLKLSVSQKTRLHTELHECSICRKSFYVDLQFGHHTALSGSSPYERNEYE
KLFCDGTAFIVHQEAYTRKIAQEYKVSNRTWGKPALFKHQIIQMGGKPYEYYENRKNFSK
KSHPTQPRRPHVGEKTFECGECGKMFWEKSNLTQHQRTHTGEKPYECTECGKAFCQKPHL
TNHQRTHTGEKPYECKQCGKTFCVKSNLTEHQRTHTGEKPYECNACRKSFCHRSALTVHQ
RTHTGEKPFICSECGKSFCVKSNLIVHQRTHTGEKPYKCNECGKTFCEKSALTKHQRTHT
GEKPYECHVCGKTFSQRSVLTKHLRIHTRVKALLAS
Download sequence
Identical sequences 10090.ENSMUSP00000068807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]