SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000096572 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000096572
Domain Number 1 Region: 211-312
Classification Level Classification E-value
Superfamily HMG-box 1.01e-20
Family HMG-box 0.0000878
Further Details:      
 
Domain Number 2 Region: 93-173
Classification Level Classification E-value
Superfamily HMG-box 3.27e-20
Family HMG-box 0.0000849
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000096572
Sequence length 394
Comment (Mus musculus)
Sequence
MTSLDNQGLWSEKDILKLLECMEHNIPSDDSREFKKSQADLNWSKVAFGLFSGEMCKQKW
MEISYNLRKFRTLTELVQEAKFSFTKKTHKNKILTEHPDRPKRPLTAYLRFYKEQRAKYC
QMYPKYSNAQLTKILAEKYRQLPAEIKQRYIMDFKKEKEDFQKKMRQFKKRHPVSGHPKK
SVVPQSHPTKVPTKSQGDIKNVKSLVKTESPRTVSSDMKFQGEPRKPPMNAYHKFHQESW
SSPELRHLSFRKRWVEISRRWHQVPENEKEHYSNQVKRLQKQYRVKLDLWLKRLSPEEYA
AYKEAKATCGKRKNMSMSGGRSSKFGRTEQSSSEKGLQIKPGEVEELLDPGTDSSGTIQG
HHDGAQSSRQDFTDDSEEDDSSTSSDSSSTDEDD
Download sequence
Identical sequences Q3USZ2
ENSMUSP00000096572 10090.ENSMUSP00000096572 ENSMUSP00000096572 ENSMUSP00000096572 ENSMUSP00000126540 ENSMUSP00000129611 NP_001028965.1.92730 XP_011240880.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]