SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000102628 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000102628
Domain Number 1 Region: 21-146
Classification Level Classification E-value
Superfamily Lysozyme-like 1.37e-45
Family C-type lysozyme 0.0000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000102628
Sequence length 148
Comment (Mus musculus)
Sequence
MLKALFICVASCLLVVNDGNIIHRCSLAKILYEEDLDGFEGYSLPDWLCLAFVESNFNIS
KVNENVDGSFDYGIFQINSRYWCNDYQSHSENFCHVDCQELLSPNLISTIHCAKKIVSGP
GGMKNWVEWKLHCLGRPLSYWMTGCHLG
Download sequence
Identical sequences A0A077S2U3 Q9DA11
ENSMUSP00000021328 ENSMUSP00000102628 10090.ENSMUSP00000102628 NP_081359.1.92730 XP_006534178.1.92730 ENSMUSP00000021328 ENSMUSP00000021328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]