SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000103710 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000103710
Domain Number 1 Region: 732-919,1232-1315,1505-1566
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.91e-103
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000096
Further Details:      
 
Domain Number 2 Region: 178-356
Classification Level Classification E-value
Superfamily EF-hand 1.36e-26
Family Calmodulin-like 0.0018
Further Details:      
 
Domain Number 3 Region: 370-424,518-585
Classification Level Classification E-value
Superfamily DUSP-like 1.01e-23
Family DUSP, domain in ubiquitin-specific proteases 0.0038
Further Details:      
 
Domain Number 4 Region: 16-165
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000226
Family Calmodulin-like 0.015
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000103710
Domain Number - Region: 645-704
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000474
Family Ubiquitin-related 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000103710
Sequence length 1604
Comment (Mus musculus)
Sequence
MGAKESRIGFLSYEEALRRVTDVELKRLKDAFKRTCGLSYYMSQHCFIREVLGDGVPPKV
AEVIYCSFGGTSKGLHFNNLIVGLVLLTRGKDEEKAKYIFSLFSSESGSYVVREEMERML
HVVDGKVPDTLRKCFSEGEKVNYEKFRNWLLLNKDAFTFSRWLLSGGVYVTLTDDSDTPT
FYQTLAGVTHLEESDIIDLEKRYWLLKAQSRTGRFDLETFGPLVSPPIRPSLSEGLFNAF
DENRDNHIDFKEISCGLSACCRGPLAERQKFCFKVFDVDRDGVLSRVELKDMVVALLEVW
KDNRTDDIPELHMDLSDIVERILNAHDTTKVGHLTLEDYQIWSVKNVLANEFLNLLFQVC
HIVLGLRPATPEEEGQIIRGWLERESRYGLQPGHNWFIISMQWWQQWKEYVKYDASPVVI
EPSSVLNGGKFSFGTAAHPIEHGEDRISNNLGYMNTTEEKYSDNISSASEASESTGSGFL
YSGTPGADMCFARQHNTSDNNNQCLLGANGNILLHLNPQKPGAIDNQPLVTQEPVKATSL
TLEGGRLKRTPQLIHGRDYEMVPEPVWRALYHWYGSNLALPRPVIKNSKTDIPELELFPR
YLLFLRQQPATRTQQSNIWVNMGNVPSPNAPLKRVLAYTGCFSRMQTIKEIHEYLSQRLR
IKEEDMRLWLYNSENYLTLLDDEDHRLEYLKIQDEQHLVIEVRNKDMSWPEEMSFIANSS
KIDRHKVPTEKGATGLSNLGNTCFMNSSIQCVSNTQPLTQYFISGRHLYELNRTNPIGMK
GHMAKCYGDLVQELWSGTQKNVAPLKLRWTIAKYAPRFNGFQQQDSQELLAFLLDGLHED
LNRVHEKPYVELKDSDGRPDWEVAAEAWDNHLRRNRSIVVDLFHGQLRSQVKCKTCGHIS
VRFDPFNFLSLPLPMDSYMHLEITVIKLDGTTPIRYGLRLNMDEKYTGLKKQLSDLCGLK
SEQILFAEVHSSNIKNFPQDNQKVRLSVSGFLCAFEIPIPASPVSACSPIQTDCSSSPST
NGLFTLTTNGDLPRPIFIPNGMPNTVVPCGTEKNVTNGIVNGHMPPLPDDPFTGYIIAVH
RKMMRTELYFLSSQKNRPSLFGMPLIVPCTVHTRKKDLYDAVWIQVSRLASPLPPQEASN
HAQDCDDSMGYQYPFTLRVVQKDGNSCAWCPWYRFCRGCKIDCGEDRAFIGNACIAVDWD
PTALHLRYQTSQERVVEEHESVEQSRRAQAEPINLDSCLRAFTSEEELGENEMYYCSKCK
THCLATKKLDLWRLPPILIIHLKRFQFVNGRWIKSQKIVKFPRESFDPSAFLVPRDPTLC
QHKPLTPQGDDFSELRIPAGDVKKVDIQSSAGEEDVLLSKSPSSLSANVTSSPKGSPSSS
RKSGASCPSSKNSSPNSSPRTLGRNKGRLRLPQIGSKNKLSNSKENLDTSKENGAGQICE
LADTLNRRHVLGGSQPELVTPLDHEITLANGFLYEHEACGNGYSNGQLGNHSEEDSTDDQ
REETHSKPIYNLYAISCHSGILGGGHYVTYAKNPNCKWYCYNDSSCKELHPDEIDTDSAY
ILFYEQQGIDCAQFLPKTDGKKMADTSSMDEDFESDYKKYCVLQ
Download sequence
Identical sequences F8VPZ3
NP_001025105.1.92730 10090.ENSMUSP00000103710 ENSMUSP00000103710 ENSMUSP00000000821 ENSMUSP00000103710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]