SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000105616 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  10090.ENSMUSP00000105616
Domain Number - Region: 141-282
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.000628
Family Terpene synthases 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000105616
Sequence length 430
Comment (Mus musculus)
Sequence
MELLKALLLLSGVFGALAEFCVIPRIDSQLVEKLGQRLLPWMDRLSSEQLNPSVFVGLRL
SSMQAGTKEDLYLHSLKIHYQQCLLRSTSSDDNSSCQPKLSGGSLALYLLALRANCEFFG
SRKGDRLISQLKWFLEDEKKAIGHNHEGHPNTNYYQYGLSILALCVHQKRLHDSVVGKLL
YAVEHDYFTYQGHVSVDTEAMAGLALTCLERFNFNSDLRPRITMAIETVREKILKSQAPE
GYFGNIYSTPLALQMLMTSPASGVGLGTACIKAGTSLLLSLQDGAFQNPLMISQLLPILN
HKTYLDLIFPDCQASRVMLVPAVEDPVHISEVISVTLKVASALSPYEQTFFVFAGSSLED
VLKLAQDGGGFTYGTQASLSGPYLTSVLGKDAGDREYWQLLRAPDTPLLQGIADYKPQDG
ETIELRLVRW
Download sequence
Identical sequences O88968
NP_001123930.1.92730 NP_001123931.1.92730 NP_056564.1.92730 XP_006514673.1.92730 XP_006514674.1.92730 XP_006514675.1.92730 XP_006514676.1.92730 10090.ENSMUSP00000105616 ENSMUSP00000020710 ENSMUSP00000105615 ENSMUSP00000105616 ENSMUSP00000105617 ENSMUSP00000105618 ENSMUSP00000105619 ENSMUSP00000105620 ENSMUSP00000020710 ENSMUSP00000020710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]