SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000106304 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000106304
Domain Number 1 Region: 54-370
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.94e-122
Family Transglutaminase core 0.0000000115
Further Details:      
 
Domain Number 2 Region: 514-611
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 9.94e-26
Family Transglutaminase, two C-terminal domains 0.00055
Further Details:      
 
Domain Number 3 Region: 394-512
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 5.23e-23
Family Transglutaminase, two C-terminal domains 0.0024
Further Details:      
 
Domain Number 4 Region: 3-52
Classification Level Classification E-value
Superfamily E set domains 0.0000000000266
Family Transglutaminase N-terminal domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000106304
Sequence length 616
Comment (Mus musculus)
Sequence
MIDSNSLQVSIFSPASAVIGHYTLKLEISQGQGPGVTYPLGNFILLFNPWSTEDDVYLPS
ETLLREYIMSDYGFIYKGQTNSITSRPWNYGQFEEDIVDICFEILNKSLYFLKNPSKDHS
QRNNVVYVCRVVSAMINSNDDSGVLQGNWGEDYSQGTSPLEWNGSVAILRQWSAKGGQPV
KYGQCWVFASVMCTVMRCLGVPTRVVSNFHSAHNTDGNLTIDTYYDRTAEMLTAQRPDKI
WNFHVWNECWMIRKDLPPGYNGWQVLDPTPQQTSSGLFCCGPASVKAIKEGDVQLPYDTP
FVYAEVNADEVVWLFEGGQVQEILAHNTSYIGKAISTKMVGSDERLDITSSYKYPEGSSE
ERSAFIKASWKLLEPRRNASSLLDLLGSENLKAKPVRLQLHLVRAPMWGQDLPLMLYVQR
VPVRDHVQGSVGLTVRFCAQALLHGGGTRKPFWRHIVHLNVDFEKELQWPFLLPYSSYRD
KLTDERLIRVAGIAEVEETGQFILVLKDFSLEPPHLSIEVFERAEVGKALDIHITLTNTL
MVPLNNCTMVLEGSGLINGQMTKDLGTLMAGHTIRIHLELYPIKAGPHQLQVLISSSEVK
EIKGYKDILVAAAPAS
Download sequence
Identical sequences A2ART8
ENSMUSP00000106303 ENSMUSP00000106303 ENSMUSP00000106303 10090.ENSMUSP00000106304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]