SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000106541 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000106541
Domain Number 1 Region: 118-620
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.51e-160
Family Calponin-homology domain, CH-domain 0.00000000243
Further Details:      
 
Domain Number 2 Region: 5-92
Classification Level Classification E-value
Superfamily EF-hand 5.53e-18
Family Calmodulin-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000106541
Sequence length 627
Comment (Mus musculus)
Sequence
MARGSVSDEEMMELREAFAKVDTDGNGYISCNELNDLFKAACLPLPGYRVREITENLMAT
GDLDQDGKISFDEFIKVFHGLKSTEVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSE
EEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFNAVGDGIVLCKMINLSVPDTIDERTI
NKKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPYLVLGLLWQVIKIGLFADI
ELSRNEALIALLREGESLEDLMKLSPEELLLRWANYHLENAGCTKITNFSTDIKDSKAYY
HLLEQVAPKGDEEGIPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFVTATDVVRGNP
KLNLAFIANLFNKYPALHKPENQDIDWGALEGETREERTFRNWMNSLGVNPRVNHLYSDL
SDALVIFQLYEKIKVPVDWNRVNKPPYPKLGGNMKKLENCNYAVDLGKNQAKFSLVGIAG
QDLNEGNRTLTLALVWQLMRRYTLNILEDIGGGQKVNDDIIVNWVNTTLKEAQKSSSIAS
FKDPKISTSLPVLDLIDAIQPGSINYDLLKTENLDDEEKLNNAKYAISMARKIGARVYAL
PEDLVEVNPKMVMTVFACLMGKGMKRV
Download sequence
Identical sequences Q61233
ENSMUSP00000117984 10090.ENSMUSP00000106541 NP_001234913.1.92730 NP_032905.2.92730 XP_006518762.1.92730 XP_006518764.1.92730 XP_006518765.1.92730 XP_006518766.1.92730 XP_006518767.1.92730 XP_017171409.1.92730 ENSMUSP00000116271 ENSMUSP00000116271 ENSMUSP00000117137 ENSMUSP00000121201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]