SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000112135 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000112135
Domain Number 1 Region: 44-135
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 7.32e-39
Family SCAN domain 0.0000462
Further Details:      
 
Domain Number 2 Region: 349-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.68e-26
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 395-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-19
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 4 Region: 311-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.25e-18
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 479-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-17
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 6 Region: 209-253
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000222
Family KRAB domain (Kruppel-associated box) 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000112135
Sequence length 553
Comment (Mus musculus)
Sequence
MARESRESTTLDSHSAEDQMELLVIKVEQEEASPLAEETSWLGSPGPDRSRQRFRAFRYP
EAAGPRQALSRLRELCRQWLRPDMHSKEQILELLVLEQFLTILPGELQAWVREQHPDSGE
EVVALLEYLDRQLDDTPPQVPDDDDGQELLCSKAVLLTSAQGSESSQMEPVEPLLKQESL
GSLPSEVRVTHVGHCGEDGVTATRLTSELQGLLKMEDVAPVLSPRWTEQDSSQMNLYKDG
MQEHSGSLVSLDQDMQTKVRDLPRAEEYRDQKPEQTVCFLGEDTVPIPTGAEASEQEGKL
QAAQKSATGTRRFYCRECGKSFAQSSGLSKHKRIHTGLKPYECEECGKAFIGSSALIIHQ
RVHTGEKPYECEECGKAFSHSSDLIKHQRTHTGEKPYECDDCGKTFTQSCSLLEHHRIHT
GEKPYQCNMCPKAFRRSSHLLRHQRTHTGDKDFFVPEPYWESQSRVESHWENIETPVSYQ
CNDCERSFSRITSLIEHQKVHTGEKPFECQTCGKGFTRPSYLIQHQRRHTGKKTSVTVTP
AVHSEVGVQLSLN
Download sequence
Identical sequences A0A0R4J1L3
10090.ENSMUSP00000112135 ENSMUSP00000068424 NP_001139250.1.92730 NP_076174.3.92730 XP_006516852.1.92730 XP_006516853.1.92730 ENSMUSP00000068424 ENSMUSP00000068424 ENSMUSP00000112135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]