SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000114026 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000114026
Domain Number 1 Region: 64-177
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-28
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 2 Region: 272-386
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000353
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 3 Region: 474-511
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000563
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 185-222
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000262
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 231-270
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000117
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 435-472
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.0028
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000114026
Domain Number - Region: 385-433
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0038
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000114026
Sequence length 790
Comment (Mus musculus)
Sequence
MEKRAAAGPEGAPGARAPLAVVCLVNLFLTGRLSSAVPALGKAGATWGFGFQAATEPTGT
QAACSGKLEQHTERRGVIYSPAWPLNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQC
SLDWLLLGPAAPPRQEAFRLCGSAIPPAFISARDHVWIFFHSDASSSGQAQGFRLSYIRG
KLGQTSCQTDEFRCDNGKCLPGPWQCNMVDECGDGSDEGNCSAPASEPPGSLCPGGTFPC
SGARSTRCLPVERRCDGTQDCGDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSD
LHCTWLVDTQDPRRVLLQLELRLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAA
QGRLTVAYHARARSAGHGFNATYQVKGYCLPWEQPCGSSEGDDDSTGEQGCFSEPQRCDG
WWHCASGRDEQGCPACPPDQYPCEGGSGLCYAPADRCNNQKSCPDGADEKNCFSCQPGTF
HCGTNLCIFETWRCDGQEDCQDGSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAF
KLYSLRTQEYRAFETQMTRLEAEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQASVLQ
NLRTAMRRQMRRHASRRGPSRRRLGRLWNRLFHRPRAPRGQIPLLTAARTSQTVLGDGLL
QAAPGPVPEPPAPNTDTGSPREAGDGPPSGSGHAPEVGPSVPPPPLNLRDPEYRPEDKER
KACVEPLEDSPAPVDTPPEPCLAQDPHPQTPTASGTQDPHSAEPLGVCRSPPPPCSPILE
ASDDEALLVC
Download sequence
Identical sequences E9Q1T6
ENSMUSP00000113406 NP_001019878.1.92730 10090.ENSMUSP00000114026 ENSMUSP00000114026 ENSMUSP00000114026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]