SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 10090.ENSMUSP00000115071 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10090.ENSMUSP00000115071
Domain Number 1 Region: 103-265
Classification Level Classification E-value
Superfamily C-type lectin-like 3.71e-19
Family C-type lectin domain 0.0061
Further Details:      
 
Domain Number 2 Region: 25-67
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000484
Family LDL receptor-like module 0.0012
Further Details:      
 
Weak hits

Sequence:  10090.ENSMUSP00000115071
Domain Number - Region: 264-329
Classification Level Classification E-value
Superfamily FnI-like domain 0.000429
Family VWC domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10090.ENSMUSP00000115071
Sequence length 580
Comment (Mus musculus)
Sequence
MVPKADSGAFLLLFLLVLTVTEPLRPELRCNPGQFACHGGTIQCIPLPWQCDGWPTCEDK
SDEADCPEVTGEARPYGKETVDLRQGRARGGDPTHFHTVNVAQPVRFSSFLGKCPSGWHH
YEGTASCYRVYLSGENYWDAAQTCQRVNGSLATFSTDQELRFVLAQEWDQPERSFGWKDQ
RKLWVGYQYVITGRNHSLEGRWEVAFKGSPEVFLPPDPIFASAMSENDNVFCAQLQCFHF
PTLRHHDLHSWHAESCSEKSSFLCKRSQTCVDIKDNVVDEGFYFTPKGDDPCLSCTCHRG
EPEMCVAALCERPQGCQQYRKDPKECCKFMCLDPDGSSLFDSMASGMRLVVSCISSFLIL
SLLLFMVHRLRQRRRERIESLIGANLHHFNLGRRIPGFDYGPDGFGTGLTPLHLSDDGEG
GTFHFHDPPPPYTAYKYPDMDQPDDPPPPYEASINPDSVFYDPADDDAFEPVEASLPAPR
DGGIEGALPRHLDQPLPPAETSLADLEDSTDSSSALLVPPDPAQSGSTPATEAPPGVLRS
QPLQHHVGPGLLAQLPPYTTGGTGGLQWYLVLRLPRPKVW
Download sequence
Identical sequences E9Q548
ENSMUSP00000115071 ENSMUSP00000115071 10090.ENSMUSP00000115071 ENSMUSP00000115071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]